PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G59580.2
Common NameNLP9, T16L24.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 894aa    MW: 98713 Da    PI: 5.295
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G59580.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-29533583252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek++sl++l++yFs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  AT3G59580.2 533 EKNVSLNVLQQYFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 583
                  89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.109517603IPR003035RWP-RK domain
PfamPF020422.8E-27535583IPR003035RWP-RK domain
SuperFamilySSF542772.0E-22781878No hitNo description
Gene3DG3DSA:3.10.20.2409.4E-23789872No hitNo description
PROSITE profilePS5174520.99792875IPR000270PB1 domain
SMARTSM006662.6E-24792875IPR000270PB1 domain
CDDcd064074.40E-34793874No hitNo description
PfamPF005643.3E-17793874IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
MENPSASRDN KGFCFPDIPV EEMDGWVKNL ISEEDMFSSS STSELMNFES FASWCNSPSA  60
ADILFTQYGL STSQSIIPFG GLEGSYACEK RPLDCTSVPR SLSHSLDEKM LKALSLFMEF  120
SGEGILAQFW TPIKTGDQYM LSTCDQAYLL DSRLSGYREA SRRFTFSAEA NQCSYPGLPG  180
RVFISGVPEW TSNVMYYKTA EYLRMKHALD NEVRGSIAIP VLEASGSSCC AVLELVTCRE  240
KPNFDVEMNS VCRALQAVNL QTSTIPRRQY LSSNQKEALA EIRDVLRAVC YAHRLPLALA  300
WIPCSYSKGA NDELVKVYGK NSKECSLLCI EETSCYVNDM EMEGFVNACL EHYLREGQGI  360
VGKALISNKP SFSSDVKTFD ICEYPLVQHA RKFGLNAAVA TKLRSTFTGD NDYILEFFLP  420
VSMKGSSEQQ LLLDSLSGTM QRLCRTLKTV SDAESIDGTE FGSRSVEMTN LPQATVSVGS  480
FHTTFLDTDV NSTRSTFSNI SSNKRNEMAG SQGTLQQEIS GARRLEKKKS STEKNVSLNV  540
LQQYFSGSLK DAAKSLGVCP TTLKRICRQH GIMRWPSRKI NKVNRSLRKI QTVLDSVQGV  600
EGGLKFDSVT GEFVAVGPFI QEFGTQKSLS SHDEDALARS QGDMDEDVSV EPLEVKSHDG  660
GGVKLEEDVE TNHQAGPGSL KKPWTWISKQ SGLIYSDDTD IGKRSEEVNK DKEDLCVRRC  720
LSSVALAGDG MNTRIERGNG TVEPNHSISS SMSDSSNSSG AVLLGSSSAS LEQNWNQIRT  780
HNNSGESGSS STLTVKATYR EDTVRFKLDP YVVGCSQLYR EVAKRFKLQE GAFQLKYLDD  840
EEEWVMLVTD SDLHECFEIL NGMRKHTVKF LVRDIPNTAM GSSAGSNGYL GTGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.346130.0inflorescence| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251472_at0.0
Expression AtlasAT3G59580-
AtGenExpressAT3G59580-
ATTED-IIAT3G59580-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G59580.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G59580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2206740.0AK220674.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL21-80-B11.
GenBankBT0104590.0BT010459.1 Arabidopsis thaliana RWP-RK domain containing protein (At3g59580) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001030895.10.0nodule inception protein-like protein 9
RefseqNP_191517.10.0nodule inception protein-like protein 9
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLD7LWE80.0D7LWE8_ARALL; Predicted protein
STRINGAT3G59580.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  4. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  5. Gong P,Wu G,Ort DR
    Slow dark deactivation of Arabidopsis chloroplast ATP synthase caused by a mutation in a nonplastidic SAC domain protein.
    Photosyn. Res., 2006. 88(2): p. 133-42
    [PMID:16453058]